GSTZ1 anticorps

N° du produit ABIN629755

Détail du produit anti-GSTZ1 anticorps

Antigène: GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTZ1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GSTZ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTZ1 Blocking Peptide, catalog no. 33R-6317, is also available for use as a blocking control in assays to test for specificity of this GSTZ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTZ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTZ1

Antigène: GSTZ1 (Glutathione Transferase zeta 1 (Maleylacetoacetate Isomerase) (GSTZ1))

Autre désignation: GSTZ1 (GSTZ1 Produits)

Synonymes: anticorps GSTZ1-1, anticorps MAAI, anticorps MAI, anticorps zgc:113898, anticorps zgc:92869, anticorps PSPTO3554, anticorps DDBDRAFT_0204466, anticorps DDBDRAFT_0231608, anticorps DDB_0204466, anticorps DDB_0231608, anticorps CG9362, anticorps Dmel\CG9362, anticorps gstz1, anticorps glutathione S-transferase zeta 1, anticorps glutathione transferase zeta 1 (maleylacetoacetate isomerase), anticorps maleylacetoacetate isomerase, anticorps Glutathione S transferase Z1, anticorps glutathione S-transferase zeta 1 L homeolog, anticorps GSTZ1, anticorps Gstz1, anticorps gstz1, anticorps maiA, anticorps hmgC, anticorps Patl_1448, anticorps Pnap_2807, anticorps Bind_0562, anticorps Bphyt_0577, anticorps Dtpsy_1678, anticorps Hbal_2638, anticorps mai, anticorps BC1002_0299, anticorps Fbal_2576, anticorps Mesop_3937, anticorps GstZ1, anticorps gstz1.L

Sujet: GSTZ1 is a member of the glutathione S-transferase (GSTs) super-family which are important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia.

Poids moléculaire: 24 kDa (MW of target protein)