ITGB1BP2 anticorps

N° du produit ABIN629756

Détail du produit anti-ITGB1BP2 anticorps

Antigène: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ITGB1BP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: ITGB1 BP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ITGB1BP2 Blocking Peptide, catalog no. 33R-6461, is also available for use as a blocking control in assays to test for specificity of this ITGB1BP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ITGB1BP2

Antigène: ITGB1BP2 (Integrin beta 1 Binding Protein (Melusin) 2 (ITGB1BP2))

Autre désignation: ITGB1BP2 (ITGB1BP2 Produits)

Synonymes: anticorps CHORDC3, anticorps ITGB1BP, anticorps MELUSIN, anticorps Chordc3, anticorps RGD1565015, anticorps integrin subunit beta 1 binding protein 2, anticorps integrin beta 1 binding protein 2, anticorps ITGB1BP2, anticorps Itgb1bp2

Sujet: ITGB1BP2 may play a role during maturation and/or organization of muscles cells.

Poids moléculaire: 38 kDa (MW of target protein)