C1orf33 anticorps

N° du produit ABIN629771

Détail du produit anti-C1orf33 anticorps

Antigène: C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C1orf33 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRTO4 Blocking Peptide, catalog no. 33R-8557, is also available for use as a blocking control in assays to test for specificity of this MRTO4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRTO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C1orf33

Antigène: C1orf33 (MRTO4) (mRNA Turnover 4 Homolog (MRTO4))

Autre désignation: MRTO4 (MRTO4 Produits)

Synonymes: anticorps mrt4, anticorps wu:fb71a02, anticorps zgc:110388, anticorps C1orf33, anticorps MRT4, anticorps dJ657E11.4, anticorps RGD1311709, anticorps 2610012O22Rik, anticorps Mg684, anticorps Mrt4, anticorps MRT4 homolog, ribosome maturation factor L homeolog, anticorps MRT4 homolog, ribosome maturation factor, anticorps mRNA turnover 4, ribosome maturation factor, anticorps mrto4.L, anticorps mrto4, anticorps MRTO4, anticorps Mrto4

Sujet: MRTO4 is a protein sharing a low level of sequence similarity with ribosomal protein P0. While the precise function of the protein is currently unknown, it appears to be involved in mRNA turnover and ribosome assembly.

Poids moléculaire: 27 kDa (MW of target protein)