Peroxiredoxin 6 anticorps (Middle Region)

N° du produit ABIN629774

Détail du produit anti-Peroxiredoxin 6 anticorps

Antigène: Peroxiredoxin 6 (PRDX6)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peroxiredoxin 6 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRDX6 antibody was raised against the middle region of PRDX6

Purification: Purified

Immunogène: PRDX6 antibody was raised using the middle region of PRDX6 corresponding to a region with amino acids ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRDX6 Blocking Peptide, catalog no. 33R-1499, is also available for use as a blocking control in assays to test for specificity of this PRDX6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peroxiredoxin 6

Antigène: Peroxiredoxin 6 (PRDX6)

Autre désignation: PRDX6 (PRDX6 Produits)

Synonymes: anticorps 1-Cys, anticorps AOP2, anticorps NSGPx, anticorps PRX, anticorps aiPLA2, anticorps p29, anticorps 1-cysPrx, anticorps 9430088D19Rik, anticorps AA690119, anticorps Aop2, anticorps Aop2-rs3, anticorps Brp-12, anticorps CC26, anticorps CP-3, anticorps GPx, anticorps Ltw-4, anticorps Ltw4, anticorps Lvtw-4, anticorps NSGP, anticorps ORF06, anticorps Prdx5, anticorps Prdx6-rs3, anticorps mKIAA0106, anticorps zgc:73360, anticorps aop2, anticorps prx-6, anticorps prx6, anticorps prdx6, anticorps PHGPX, anticorps peroxiredoxin 6, anticorps peroxiredoxin 6 S homeolog, anticorps peroxiredoxin 6 L homeolog, anticorps PRDX6, anticorps Prdx6, anticorps prdx6, anticorps prdx6.S, anticorps prdx6.L

Sujet: PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell, it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury.

Poids moléculaire: 25 kDa (MW of target protein)