NSUN5P2 anticorps (Middle Region)

N° du produit ABIN629781

Détail du produit anti-NSUN5P2 anticorps

Antigène: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NSUN5P2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NSUN5 C antibody was raised against the middle region of NSUN5

Purification: Purified

Immunogène: NSUN5 C antibody was raised using the middle region of NSUN5 corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NSUN5C Blocking Peptide, catalog no. 33R-6965, is also available for use as a blocking control in assays to test for specificity of this NSUN5C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NSUN5P2

Antigène: NSUN5P2 (NOP2/Sun Domain Family, Member 5 Pseudogene 2 (NSUN5P2))

Autre désignation: NSUN5C (NSUN5P2 Produits)

Synonymes: anticorps NOL1R2, anticorps NSUN5C, anticorps WBSCR20B, anticorps WBSCR20C, anticorps NOP2/Sun RNA methyltransferase family member 5 pseudogene 2, anticorps NSUN5P2

Sujet: NSUN5C gene shares high sequence similarity with several genes in the Williams Beuren Syndrome critical region and its deletion is associated with this disorder.

Poids moléculaire: 34 kDa (MW of target protein)