ALT anticorps

N° du produit ABIN629788

Détail du produit anti-ALT anticorps

Antigène: ALT (Alanine Aminotransferase (ALT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALT est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids CGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAI

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPT Blocking Peptide, catalog no. 33R-1697, is also available for use as a blocking control in assays to test for specificity of this GPT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALT

Antigène: ALT (Alanine Aminotransferase (ALT))

Autre désignation: GPT (ALT Produits)

Synonymes: anticorps AAT1, anticorps ALT1, anticorps GPT1, anticorps GPT, anticorps Gpt1, anticorps An11g02620, anticorps AO090003000164, anticorps 233.t00009, anticorps 24.t00016, anticorps 1300007J06Rik, anticorps 2310022B03Rik, anticorps ALT, anticorps Gpt-1, anticorps AU021132, anticorps Dpagt2, anticorps Gnpta, anticorps gpt, anticorps ALANINE AMINOTRANSFERAS, anticorps AtAlaAT1, anticorps AtAlaATc, anticorps T13M22.3, anticorps T13M22_3, anticorps alanine aminotransferas, anticorps glutamic--pyruvic transaminase, anticorps glutamic-pyruvate transaminase (alanine aminotransferase), anticorps alanine aminotransferase, anticorps alanine aminotransferase 1, anticorps glutamic pyruvic transaminase, soluble, anticorps dolichyl-phosphate (UDP-N-acetylglucosamine) acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase), anticorps alanine aminotransferase 2-like, anticorps Alanine aminotransferase 1, mitochondrial, anticorps GPT, anticorps Gpt, anticorps Tb927.1.3950, anticorps ANI_1_368094, anticorps AOR_1_284154, anticorps ALAT_1, anticorps ALAAT1, anticorps EHI_159710, anticorps EHI_096750, anticorps LOC5572541, anticorps ALAT, anticorps AAT2, anticorps Dpagt1, anticorps LOC100537633, anticorps AlaAT1

Sujet: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.

Poids moléculaire: 55 kDa (MW of target protein)