XRCC5 anticorps
-
- Antigène Voir toutes XRCC5 Anticorps
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp XRCC5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- XRCC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
- Top Product
- Discover our top product XRCC5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
XRCC5 Blocking Peptide, catalog no. 33R-3345, is also available for use as a blocking control in assays to test for specificity of this XRCC5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRCC5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- XRCC5 (X-Ray Repair Complementing Defective Repair in Chinese Hamster Cells 5 (Double-Strand-Break Rejoining) (XRCC5))
- Autre désignation
- XRCC5 (XRCC5 Produits)
- Synonymes
- anticorps AI314015, anticorps Ku80, anticorps Ku86, anticorps Kup80, anticorps KARP-1, anticorps KARP1, anticorps KU80, anticorps KUB2, anticorps NFIV, anticorps xrcc5-a, anticorps XRCC5, anticorps X-ray repair cross complementing 5, anticorps X-ray repair complementing defective repair in Chinese hamster cells 5, anticorps X-ray repair complementing defective repair in Chinese hamster cells 5 L homeolog, anticorps XRCC5, anticorps Xrcc5, anticorps xrcc5.L
- Sujet
- XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.
- Poids moléculaire
- 83 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-