MAGEA1 anticorps

N° du produit ABIN629810

Détail du produit anti-MAGEA1 anticorps

Antigène: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAGEA1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MAGEA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAGEA1 Blocking Peptide, catalog no. 33R-6107, is also available for use as a blocking control in assays to test for specificity of this MAGEA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAGEA1

Antigène: MAGEA1 (Melanoma Antigen Family A, 1 (Directs Expression of Antigen MZ2-E) (MAGEA1))

Autre désignation: MAGEA1 (MAGEA1 Produits)

Synonymes: anticorps CT1.1, anticorps MAGE1, anticorps Mage-a1, anticorps MAGE family member A1, anticorps melanoma antigen, family A, 1, anticorps MAGEA1, anticorps Magea1

Sujet: The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.

Poids moléculaire: 34 kDa (MW of target protein)