TRUB2 anticorps (Middle Region)

N° du produit ABIN629818

Détail du produit anti-TRUB2 anticorps

Antigène: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRUB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRUB2 antibody was raised against the middle region of TRUB2

Purification: Purified

Immunogène: TRUB2 antibody was raised using the middle region of TRUB2 corresponding to a region with amino acids MNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRUB2 Blocking Peptide, catalog no. 33R-6249, is also available for use as a blocking control in assays to test for specificity of this TRUB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRUB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRUB2

Antigène: TRUB2 (TruB Pseudouridine (Psi) Synthase Homolog 2 (TRUB2))

Autre désignation: TRUB2 (TRUB2 Produits)

Synonymes: anticorps CLONE24922, anticorps RP11-339B21.1, anticorps G430055L02Rik, anticorps fc51e05, anticorps wu:fc51e05, anticorps zgc:91836, anticorps TruB pseudouridine synthase family member 2, anticorps TruB pseudouridine (psi) synthase family member 2, anticorps TruB pseudouridine (psi) synthase homolog 2 (E. coli), anticorps TruB pseudouridine (psi) synthase family member 2 L homeolog, anticorps TRUB2, anticorps trub2, anticorps trub2.L, anticorps Trub2

Sujet: Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase.

Poids moléculaire: 37 kDa (MW of target protein)