TPM2 anticorps

N° du produit ABIN629837

Détail du produit anti-TPM2 anticorps

Antigène: TPM2 (Tropomyosin-2 (TPM2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPM2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tropomyosin 2 Blocking Peptide, catalog no. 33R-1152, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPM2

Antigène: TPM2 (Tropomyosin-2 (TPM2))

Autre désignation: Tropomyosin 2 (TPM2 Produits)

Synonymes: anticorps CG4843, anticorps DROTROPI1, anticorps Dmel\\CG4843, anticorps Ifm(3)3, anticorps Ifm(3)5, anticorps Ifm-TmI, anticorps TM2, anticorps Tm, anticorps Tm1, anticorps Tm127, anticorps TmI, anticorps TmII, anticorps Tn-H, anticorps dro Tm, anticorps l(3)nc99Eb, anticorps mTmI, anticorps cb836, anticorps fb68h02, anticorps tpm4l, anticorps wu:fb68h02, anticorps wu:fj63f03, anticorps zgc:86810, anticorps AMCD1, anticorps DA1, anticorps DA2B, anticorps TMSB, anticorps nem4, anticorps tpm2, anticorps tpm2a, anticorps BRT-2, anticorps TPM3, anticorps NEM4, anticorps Tpm-2, anticorps Trop-2, anticorps Tropomyosin 2, anticorps Tropomyosin-2, anticorps tropomyosin, anticorps tropomyosin 2 (beta), anticorps tropomyosin 2 L homeolog, anticorps tropomyosin 2, anticorps tropomyosin 2, beta, anticorps Tm2, anticorps EDI_309330, anticorps LOC100101174, anticorps tpm2, anticorps tpm2.L, anticorps TPM2, anticorps Tpm2

Sujet: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Poids moléculaire: 33 kDa (MW of target protein)