TPM2 anticorps

N° du produit ABIN629837

L’anticorps anti-TPM2 Polyclonal Lapin est utilisé pour la détection de TPM2 dans des échantillons de Humain et Souris. Il a été validé pour WB et IHC.

Aperçu rapide pour TPM2 anticorps (ABIN629837)

Antigène: TPM2 (Tropomyosin-2 (TPM2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPM2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TPM2 anticorps

Purification: Purified

Immunogène: Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tropomyosin 2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPM2

Antigène: TPM2 (Tropomyosin-2 (TPM2))

Autre désignation: Tropomyosin 2

Sujet: The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.

Poids moléculaire: 33 kDa (MW of target protein)