TPM2 anticorps
-
- Antigène Voir toutes TPM2 Anticorps
- TPM2 (Tropomyosin-2 (TPM2))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TPM2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- Tropomyosin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AETRAEFAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
- Top Product
- Discover our top product TPM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tropomyosin 2 Blocking Peptide, catalog no. 33R-1152, is also available for use as a blocking control in assays to test for specificity of this Tropomyosin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TPM2 (Tropomyosin-2 (TPM2))
- Autre désignation
- Tropomyosin 2 (TPM2 Produits)
- Synonymes
- anticorps CG4843, anticorps DROTROPI1, anticorps Dmel\\CG4843, anticorps Ifm(3)3, anticorps Ifm(3)5, anticorps Ifm-TmI, anticorps TM2, anticorps Tm, anticorps Tm1, anticorps Tm127, anticorps TmI, anticorps TmII, anticorps Tn-H, anticorps dro Tm, anticorps l(3)nc99Eb, anticorps mTmI, anticorps cb836, anticorps fb68h02, anticorps tpm4l, anticorps wu:fb68h02, anticorps wu:fj63f03, anticorps zgc:86810, anticorps AMCD1, anticorps DA1, anticorps DA2B, anticorps TMSB, anticorps nem4, anticorps tpm2, anticorps tpm2a, anticorps BRT-2, anticorps TPM3, anticorps NEM4, anticorps Tpm-2, anticorps Trop-2, anticorps Tropomyosin 2, anticorps Tropomyosin-2, anticorps tropomyosin, anticorps tropomyosin 2 (beta), anticorps tropomyosin 2 L homeolog, anticorps tropomyosin 2, anticorps tropomyosin 2, beta, anticorps Tm2, anticorps EDI_309330, anticorps LOC100101174, anticorps tpm2, anticorps tpm2.L, anticorps TPM2, anticorps Tpm2
- Sujet
- The TPM2 gene encodes beta-tropomyosin, an isoform of tropomyosin that is mainly expressed in slow, type 1 muscle fibers.
- Poids moléculaire
- 33 kDa (MW of target protein)
-