DDX39 anticorps

N° du produit ABIN629972

Détail du produit anti-DDX39 anticorps

Antigène: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX39 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX39 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX39 Blocking Peptide, catalog no. 33R-5644, is also available for use as a blocking control in assays to test for specificity of this DDX39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX39

Antigène: DDX39 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39A (DDX39))

Autre désignation: DDX39 (DDX39 Produits)

Synonymes: anticorps 2610307C23Rik, anticorps BAT1, anticorps DDXL, anticorps Ddx39a, anticorps URH49, anticorps BAT1L, anticorps DDX39, anticorps Ddx39, anticorps Ddxl, anticorps ddx39a, anticorps wu:fc87b12, anticorps zgc:55881, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, anticorps DExD-box helicase 39A, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa, anticorps Ddx39, anticorps DDX39A, anticorps Ddx39a, anticorps ddx39aa

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX39 encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants encoding different isoforms.

Poids moléculaire: 47 kDa (MW of target protein)