SRP19 anticorps (Middle Region)
-
- Antigène Voir toutes SRP19 Anticorps
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SRP19 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SRP19 antibody was raised against the middle region of SRP19
- Purification
- Purified
- Immunogène
- SRP19 antibody was raised using the middle region of SRP19 corresponding to a region with amino acids LCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKK
- Top Product
- Discover our top product SRP19 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SRP19 Blocking Peptide, catalog no. 33R-4826, is also available for use as a blocking control in assays to test for specificity of this SRP19 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP19 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SRP19 (Signal Recognition Particle 19kDa (SRP19))
- Autre désignation
- SRP19 (SRP19 Produits)
- Synonymes
- anticorps 2310020D23Rik, anticorps zgc:63961, anticorps CG4457, anticorps Dmel\\CG4457, anticorps SRP19, anticorps srp19, anticorps signal recognition particle 19, anticorps signal recognition particle 19kDa L homeolog, anticorps signal recognition particle 19kDa, anticorps Signal recognition particle protein 19, anticorps SRP19, anticorps srp19.L, anticorps srp19, anticorps Srp19
- Sujet
- SRP19 belongs to the SRP19 family. It is signal-recognition-particle assembly and binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
- Poids moléculaire
- 16 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-