EIF4E2 anticorps (N-Term)

N° du produit ABIN629989

Détail du produit anti-EIF4E2 anticorps

Antigène: EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2 (EIF4E2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4E2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EIF4 E2 antibody was raised against the N terminal of EIF4 2

Purification: Purified

Immunogène: EIF4 E2 antibody was raised using the N terminal of EIF4 2 corresponding to a region with amino acids KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4E2 Blocking Peptide, catalog no. 33R-4279, is also available for use as a blocking control in assays to test for specificity of this EIF4E2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4E2

Antigène: EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2 (EIF4E2))

Autre désignation: EIF4E2 (EIF4E2 Produits)

Synonymes: anticorps 4E-LP, anticorps 4EHP, anticorps EIF4EL3, anticorps IF4e, anticorps Eif4el3, anticorps EIF4E2, anticorps id:ibd1007, anticorps zgc:110542, anticorps zgc:158544, anticorps MGC115622, anticorps 2700069E09Rik, anticorps AI036339, anticorps AV129531, anticorps D0H0S6743E, anticorps eukaryotic translation initiation factor 4E family member 2, anticorps eukaryotic translation initiation factor 4E member 2, anticorps eukaryotic translation initiation factor 4E family member 2 L homeolog, anticorps EIF4E2, anticorps Eif4e2, anticorps eif4e2, anticorps eif4e2.L

Sujet: EIF4E2 belongs to the eukaryotic initiation factor 4E family. It recognises and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome