EIF4B anticorps (C-Term)

N° du produit ABIN629991

Détail du produit anti-EIF4B anticorps

Antigène: EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF4B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EIF4 B antibody was raised against the C terminal of EIF4

Purification: Purified

Immunogène: EIF4 B antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF4B Blocking Peptide, catalog no. 33R-6824, is also available for use as a blocking control in assays to test for specificity of this EIF4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF4B

Antigène: EIF4B (Eukaryotic Translation Initiation Factor 4B (EIF4B))

Autre désignation: EIF4B (EIF4B Produits)

Synonymes: anticorps EIF-4B, anticorps PRO1843, anticorps CG10837, anticorps Dm-eIF4B, anticorps Dmel\\CG10837, anticorps Eif4B, anticorps eIF-4B-L, anticorps eIF-4B-S, anticorps eIF-4b, anticorps eIF4B, anticorps eIF4B-L, anticorps eIF4B-S, anticorps eIf4b, anticorps 2310046H11Rik, anticorps AL024095, anticorps C85189, anticorps Eif4a2, anticorps eif4b, anticorps fb15c09, anticorps wu:fb15c09, anticorps zgc:101532, anticorps MGC89384, anticorps eukaryotic translation initiation factor 4B, anticorps eukaryotic initiation factor 4B, anticorps Eukaryotic initiation factor 4B, anticorps eukaryotic translation initiation factor 4Bb, anticorps eukaryotic translation initiation factor 4Ba, anticorps eukaryotic translation initiation factor 4B S homeolog, anticorps EIF4B, anticorps Eif4B, anticorps eIF-4B, anticorps Eif4b, anticorps eif4bb, anticorps eif4b, anticorps eif4ba, anticorps eif4b.S, anticorps LOC100284982, anticorps LOC100380867

Sujet: IF4B contains 1 RRM (RNA recognition motif) domain and is required for the binding of mRNA to ribosomes. Functions of EIF4B are in close association with EEF4-F and EIF4-A. It binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP and promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F.

Poids moléculaire: 67 kDa (MW of target protein)