TRA2B anticorps
-
- Antigène Voir toutes TRA2B Anticorps
- TRA2B (Transformer 2 beta Homolog (TRA2B))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TRA2B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
- Top Product
- Discover our top product TRA2B Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SFRS10 Blocking Peptide, catalog no. 33R-3636, is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TRA2B (Transformer 2 beta Homolog (TRA2B))
- Autre désignation
- SFRS10 (TRA2B Produits)
- Synonymes
- anticorps sfrs10, anticorps SFRS10, anticorps Htra2-beta, anticorps SRFS10, anticorps TRA2-BETA, anticorps TRAN2B, anticorps 5730405G21Rik, anticorps D16Ertd266e, anticorps SIG-41, anticorps Sfrs10, anticorps Silg41, anticorps TRA2beta, anticorps Srsf10, anticorps zgc:56612, anticorps transformer 2 beta homolog (Drosophila), anticorps transformer 2 beta homolog L homeolog, anticorps transformer 2 beta homolog, anticorps tra2b, anticorps tra2b.L, anticorps TRA2B, anticorps Tra2b
- Sujet
- SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.
- Poids moléculaire
- 32 kDa (MW of target protein)
-