SSB anticorps
-
- Antigène Voir toutes SSB Anticorps
- SSB (Sjogren Syndrome Antigen B (SSB))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SSB est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids PGQKYKETDLLILFKDDYFAKKNEERKQNKVEAKLRAKQEQEAKQKLEED
- Top Product
- Discover our top product SSB Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SSB Blocking Peptide, catalog no. 33R-7124, is also available for use as a blocking control in assays to test for specificity of this SSB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SSB (Sjogren Syndrome Antigen B (SSB))
- Autre désignation
- SSB (SSB Produits)
- Synonymes
- anticorps LARP3, anticorps La, anticorps lab1, anticorps larp3, anticorps ssb, anticorps Mt-SSB, anticorps MtSSB, anticorps Ssbp1, anticorps SS-B, anticorps laa-a, anticorps ssb-a, anticorps ssb-b, anticorps wu:fb17f11, anticorps zgc:55588, anticorps Sjogren syndrome antigen B, anticorps Sjogren syndrome antigen B L homeolog, anticorps single stranded DNA binding protein 1, anticorps Sjogren syndrome antigen B S homeolog, anticorps Sjogren syndrome antigen B (autoantigen La), anticorps SSB, anticorps ssb.L, anticorps SSBP1, anticorps Ssb, anticorps ssb.S, anticorps ssb
- Sujet
- SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.
- Poids moléculaire
- 47 kDa (MW of target protein)
-