CPSF6 anticorps (Middle Region)

N° du produit ABIN630020

Détail du produit anti-CPSF6 anticorps

Antigène: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPSF6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CPSF6 antibody was raised against the middle region of CPSF6

Purification: Purified

Immunogène: CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP

Information d'application

Indications d'application: WB: 0.3125 µg/mL, IHC: 16 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPSF6 Blocking Peptide, catalog no. 33R-7262, is also available for use as a blocking control in assays to test for specificity of this CPSF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPSF6

Antigène: CPSF6 (Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6))

Autre désignation: CPSF6 (CPSF6 Produits)

Synonymes: anticorps CPSF6, anticorps wu:fa22f12, anticorps zgc:85819, anticorps 4733401N12Rik, anticorps AI256641, anticorps CFIM, anticorps CFIM68, anticorps HPBRII-4, anticorps HPBRII-7, anticorps cleavage and polyadenylation specific factor 6, anticorps cleavage and polyadenylation specific factor 6 S homeolog, anticorps CPSF6, anticorps cpsf6.S, anticorps cpsf6, anticorps Cpsf6

Sujet: CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.

Poids moléculaire: 61 kDa (MW of target protein)