CLIC4 anticorps (N-Term)

N° du produit ABIN630071

Détail du produit anti-CLIC4 anticorps

Antigène: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLIC4 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLIC4 antibody was raised against the N terminal of CLIC4

Purification: Purified

Immunogène: CLIC4 antibody was raised using the N terminal of CLIC4 corresponding to a region with amino acids LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVF

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLIC4 Blocking Peptide, catalog no. 33R-5440, is also available for use as a blocking control in assays to test for specificity of this CLIC4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLIC4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLIC4

Antigène: CLIC4 (Chloride Intracellular Channel 4 (CLIC4))

Autre désignation: CLIC4 (CLIC4 Produits)

Synonymes: anticorps CLIC4L, anticorps H1, anticorps MTCLIC, anticorps huH1, anticorps p64H1, anticorps cb142, anticorps wu:fb33c05, anticorps wu:fc30h10, anticorps clic4, anticorps MGC89006, anticorps CLIC4, anticorps DKFZp459A0325, anticorps D0Jmb3, anticorps TU-74, anticorps mc3s5, anticorps mtCLIC, anticorps xclic4, anticorps chloride intracellular channel 4, anticorps chloride intracellular channel 4 (mitochondrial), anticorps chloride intracellular channel 4 S homeolog, anticorps CLIC4, anticorps Clic4, anticorps clic4, anticorps clic4.S

Sujet: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIon Channel4) protein, encoded by the CLIon Channel4 gene, is a member of the p64 family, the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).

Poids moléculaire: 28 kDa (MW of target protein)