CACNB2 anticorps (Middle Region)

N° du produit ABIN630074

Détail du produit anti-CACNB2 anticorps

Antigène: CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNB2 antibody was raised against the middle region of CACNB2

Purification: Purified

Immunogène: CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGSQGDQRT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNB2 Blocking Peptide, catalog no. 33R-2242, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNB2

Antigène: CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit (CACNB2))

Autre désignation: CACNB2 (CACNB2 Produits)

Synonymes: anticorps CACNLB2, anticorps CAVB2, anticorps MYSB, anticorps AW060387, anticorps CAB2, anticorps Cavbeta2, anticorps Cchb2, anticorps Cacnlb2, anticorps Cacnb2, anticorps CACNB2, anticorps CACNB2.2, anticorps cacnb2a, anticorps im:7141271, anticorps si:dkey-32m20.2, anticorps calcium voltage-gated channel auxiliary subunit beta 2, anticorps calcium channel, voltage-dependent, beta 2 subunit, anticorps calcium channel, voltage-dependent, beta 2b, anticorps CACNB2, anticorps Cacnb2, anticorps cacnb2b

Sujet: CACNB2 is a member of the ion-channel geneuperfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development