CACNB3 anticorps (C-Term)
-
- Antigène Voir toutes CACNB3 Anticorps
- CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CACNB3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CACNB3 antibody was raised against the C terminal of CACNB3
- Purification
- Purified
- Immunogène
- CACNB3 antibody was raised using the C terminal of CACNB3 corresponding to a region with amino acids EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH
- Top Product
- Discover our top product CACNB3 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CACNB3 Blocking Peptide, catalog no. 33R-2461, is also available for use as a blocking control in assays to test for specificity of this CACNB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CACNB3 (Calcium Channel, Voltage-Dependent, beta 3 Subunit (CACNB3))
- Autre désignation
- CACNB3 (CACNB3 Produits)
- Synonymes
- anticorps vgcc, anticorps xo28, anticorps xo32, anticorps o32-a, anticorps cacnlb3, anticorps VGCC, anticorps CACNB3, anticorps CAB3, anticorps CACNLB3, anticorps Beta3, anticorps Cchb3, anticorps CACH3B, anticorps cacnb3, anticorps Cacnb3, anticorps calcium channel, voltage-dependent, beta 3 subunit S homeolog, anticorps calcium channel, voltage-dependent, beta 3 subunit L homeolog, anticorps calcium voltage-gated channel auxiliary subunit beta 3, anticorps calcium channel, voltage-dependent, beta 3b, anticorps calcium channel, voltage-dependent, beta 3 subunit, anticorps calcium channel, voltage-dependent, beta 3a, anticorps cacnb3.S, anticorps cacnb3.L, anticorps CACNB3, anticorps cacnb3b, anticorps cacnb3, anticorps Cacnb3, anticorps cacnb3a
- Sujet
- The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction
-