CLCN6 anticorps (C-Term)

N° du produit ABIN630094

Détail du produit anti-CLCN6 anticorps

Antigène: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLCN6 est non-conjugé

Application: Western Blotting (WB)

Specificité: CLCN6 antibody was raised against the C terminal of CLCN6

Purification: Purified

Immunogène: CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLCN6 Blocking Peptide, catalog no. 33R-7295, is also available for use as a blocking control in assays to test for specificity of this CLCN6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLCN6

Antigène: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Autre désignation: CLCN6 (CLCN6 Produits)

Synonymes: anticorps CLC-6, anticorps AI850629, anticorps CLCN6, anticorps wu:fb95f01, anticorps DKFZp469B244, anticorps DKFZp469L0417, anticorps chloride voltage-gated channel 6, anticorps chloride channel, voltage-sensitive 6, anticorps chloride channel 6, anticorps chloride transport protein 6, anticorps CLCN6, anticorps Clcn6, anticorps clcn6, anticorps LOC579870

Sujet: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.

Poids moléculaire: 39 kDa (MW of target protein)