WNT5B anticorps (C-Term)

N° du produit ABIN630136

Détail du produit anti-WNT5B anticorps

Antigène: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WNT5B est non-conjugé

Application: Western Blotting (WB)

Specificité: WNT5 B antibody was raised against the C terminal of WNT5

Purification: Purified

Immunogène: WNT5 B antibody was raised using the C terminal of WNT5 corresponding to a region with amino acids GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCT

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WNT5B Blocking Peptide, catalog no. 33R-3537, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WNT5B

Antigène: WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))

Autre désignation: WNT5B (WNT5B Produits)

Synonymes: anticorps wnt-5b, anticorps xwnt5b, anticorps WNT5B, anticorps AW545702, anticorps Wnt-5b, anticorps xwnt-5c, anticorps CHUNP6928, anticorps id:ibd5111, anticorps ppt, anticorps wnt-5, anticorps wnt5, anticorps wnt[b], anticorps wu:fk85g06, anticorps Wnt family member 5B, anticorps wingless-type MMTV integration site family, member 5B, anticorps Wnt family member 5B S homeolog, anticorps wingless-type MMTV integration site family, member 5b, anticorps wnt5b, anticorps WNT5B, anticorps Wnt5b, anticorps wnt5b.S

Sujet: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT5B gene is a member of the WNT gene family. WNT5B shows 94% and 80% amino acid identity to the mouse Wnt5b protein and the human WNT5A protein.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Signalisation WNT, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation