MCM6 anticorps (C-Term)

N° du produit ABIN630187

Détail du produit anti-MCM6 anticorps

Antigène: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MCM6 antibody was raised against the C terminal of MCM6

Purification: Purified

Immunogène: MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM6 Blocking Peptide, catalog no. 33R-7967, is also available for use as a blocking control in assays to test for specificity of this MCM6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM6

Antigène: MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))

Autre désignation: MCM6 (MCM6 Produits)

Synonymes: anticorps CG4039, anticorps DmMCM6, anticorps DmeMCM6, anticorps Dmel\\CG4039, anticorps MCM6, anticorps McM6, anticorps fs(1)K1214, anticorps mcm6, anticorps MCG40308, anticorps Mis5, anticorps P105MCM, anticorps Mcmd6, anticorps mis5, anticorps mmcm6, anticorps ASP-l1, anticorps D1Wsu22e, anticorps Minichromosome maintenance 6, anticorps DNA replication licensing factor MCM6, anticorps minichromosome maintenance complex component 6, anticorps minichromosome maintenance complex component 6 L homeolog, anticorps DNA replication licensing factor mcm-6, anticorps Mcm6, anticorps TP02_0113, anticorps PVX_114735, anticorps CMU_027970, anticorps MCM6, anticorps mcm6.L, anticorps mcm-6

Sujet: The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA