MCM6 anticorps (C-Term)
-
- Antigène Voir toutes MCM6 Anticorps
- MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))
-
Épitope
- C-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MCM6 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- MCM6 antibody was raised against the C terminal of MCM6
- Purification
- Purified
- Immunogène
- MCM6 antibody was raised using the C terminal of MCM6 corresponding to a region with amino acids RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE
- Top Product
- Discover our top product MCM6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MCM6 Blocking Peptide, catalog no. 33R-7967, is also available for use as a blocking control in assays to test for specificity of this MCM6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MCM6 (Minichromosome Maintenance Complex Component 6 (MCM6))
- Autre désignation
- MCM6 (MCM6 Produits)
- Synonymes
- anticorps CG4039, anticorps DmMCM6, anticorps DmeMCM6, anticorps Dmel\\CG4039, anticorps MCM6, anticorps McM6, anticorps fs(1)K1214, anticorps mcm6, anticorps MCG40308, anticorps Mis5, anticorps P105MCM, anticorps Mcmd6, anticorps mis5, anticorps mmcm6, anticorps ASP-l1, anticorps D1Wsu22e, anticorps Minichromosome maintenance 6, anticorps DNA replication licensing factor MCM6, anticorps minichromosome maintenance complex component 6, anticorps minichromosome maintenance complex component 6 L homeolog, anticorps DNA replication licensing factor mcm-6, anticorps Mcm6, anticorps TP02_0113, anticorps PVX_114735, anticorps CMU_027970, anticorps MCM6, anticorps mcm6.L, anticorps mcm-6
- Sujet
- The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.
- Poids moléculaire
- 90 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-