PIK3R3 anticorps

N° du produit ABIN630213

Détail du produit anti-PIK3R3 anticorps

Antigène: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIK3R3 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PIK3 R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIK3R3 Blocking Peptide, catalog no. 33R-2832, is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIK3R3

Antigène: PIK3R3 (Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3))

Autre désignation: PIK3R3 (PIK3R3 Produits)

Synonymes: anticorps AA414954, anticorps p55pik, anticorps p55, anticorps p55-GAMMA, anticorps pik3r3, anticorps zgc:55564, anticorps zgc:85710, anticorps phosphoinositide-3-kinase regulatory subunit 3, anticorps phosphoinositide-3-kinase, regulatory subunit 3 (gamma), anticorps phosphoinositide-3-kinase, regulatory subunit 3b (gamma), anticorps PIK3R3, anticorps Pik3r3, anticorps pik3r3b

Sujet: PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.

Poids moléculaire: 54 kDa (MW of target protein)