IGLL1 anticorps (N-Term)

N° du produit ABIN630214

Détail du produit anti-IGLL1 anticorps

Antigène: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGLL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGLL1 antibody was raised against the N terminal of IGLL1

Purification: Purified

Immunogène: IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGLL1 Blocking Peptide, catalog no. 33R-8211, is also available for use as a blocking control in assays to test for specificity of this IGLL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGLL1

Antigène: IGLL1 (Immunoglobulin lambda-Like Polypeptide 1 (IGLL1))

Autre désignation: IGLL1 (IGLL1 Produits)

Synonymes: anticorps 14.1, anticorps AGM2, anticorps CD179b, anticorps IGL1, anticorps IGL5, anticorps IGLJ14.1, anticorps IGLL, anticorps IGO, anticorps IGVPB, anticorps VPREB2, anticorps IGLV, anticorps IGLL1, anticorps MGC151892, anticorps Igll1, anticorps BB139905, anticorps Igl-5, anticorps Igll, anticorps Lambda5, anticorps immunoglobulin lambda like polypeptide 1, anticorps immunoglobulin lambda-like polypeptide 1, anticorps IGLL1, anticorps Igll1

Sujet: The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin geneuperfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Regulation of Cell Size