ZDHHC13 anticorps (N-Term)

N° du produit ABIN630234

Détail du produit anti-ZDHHC13 anticorps

Antigène: ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC13 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ZDHHC13 antibody was raised against the N terminal of ZDHHC13

Purification: Purified

Immunogène: ZDHHC13 antibody was raised using the N terminal of ZDHHC13 corresponding to a region with amino acids MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC13 Blocking Peptide, catalog no. 33R-6586, is also available for use as a blocking control in assays to test for specificity of this ZDHHC13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC13

Antigène: ZDHHC13 (Zinc Finger, DHHC-Type Containing 13 (ZDHHC13))

Autre désignation: ZDHHC13 (ZDHHC13 Produits)

Synonymes: anticorps ZDHHC13, anticorps 2410004E01Rik, anticorps C530010M18, anticorps HIP3RP, anticorps Hip14l, anticorps kojak, anticorps skc4, anticorps wu:fb06e01, anticorps wu:fc39g10, anticorps wu:fi22e09, anticorps zgc:101690, anticorps HIP14L, anticorps zinc finger DHHC-type containing 13, anticorps zinc finger, DHHC domain containing 13, anticorps zinc finger, DHHC-type containing 13, anticorps ZDHHC13, anticorps Zdhhc13, anticorps zdhhc13

Sujet: ZDHHC13 may be involved in the NF-kappa-B signaling pathway.

Poids moléculaire: 54 kDa (MW of target protein)