IL18RAP anticorps (N-Term)

N° du produit ABIN630238

Détail du produit anti-IL18RAP anticorps

Antigène: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL18RAP est non-conjugé

Application: Western Blotting (WB)

Specificité: IL18 RAP antibody was raised against the N terminal of IL18 AP

Purification: Purified

Immunogène: IL18 RAP antibody was raised using the N terminal of IL18 AP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL18RAP Blocking Peptide, catalog no. 33R-6858, is also available for use as a blocking control in assays to test for specificity of this IL18RAP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 AP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL18RAP

Antigène: IL18RAP (Interleukin 18 Receptor Accessory Protein (IL18RAP))

Autre désignation: IL18RAP (IL18RAP Produits)

Synonymes: anticorps IL18RAP, anticorps ACPL, anticorps CD218b, anticorps CDw218b, anticorps IL18RB, anticorps interleukin 18 receptor accessory protein, anticorps IL18RAP, anticorps Il18rap

Sujet: IL18RAP is an accessory subunit of the heterodimeric receptor for IL18. This protein enhances the IL18 binding activity of IL18R1 (IL1RRP), a ligand binding subunit of IL18 receptor. The coexpression of IL18R1 and this protein is required for the activation of NF-kappaB and MAPK8 (JNK) in response to IL18.

Poids moléculaire: 66 kDa (MW of target protein)