ADIPOQ anticorps (N-Term)

N° du produit ABIN630285

Cet anticorps anti-ADIPOQ Polyclonal Lapin (ABIN630285) détecte spécifiquement ADIPOQ dans WB et IHC. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour ADIPOQ anticorps (N-Term) (ABIN630285)

Antigène: ADIPOQ (Adiponectin (ADIPOQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADIPOQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ADIPOQ anticorps

Épitope: N-Term

Specificité: ACDC antibody was raised against the N terminal Of Acdc

Purification: Purified

Immunogène: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACDC Blocking Peptide, (ABIN939770), is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADIPOQ

Antigène: ADIPOQ (Adiponectin (ADIPOQ))

Autre désignation: ACDC

Sujet: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Poids moléculaire: 27 kDa (MW of target protein)