ADIPOQ anticorps (N-Term)

N° du produit ABIN630285

Détail du produit anti-ADIPOQ anticorps

Antigène: ADIPOQ (Adiponectin (ADIPOQ))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADIPOQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ACDC antibody was raised against the N terminal Of Acdc

Purification: Purified

Immunogène: ACDC antibody was raised using the N terminal Of Acdc corresponding to a region with amino acids KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACDC Blocking Peptide, catalog no. 33R-4384, is also available for use as a blocking control in assays to test for specificity of this ACDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADIPOQ

Antigène: ADIPOQ (Adiponectin (ADIPOQ))

Autre désignation: ACDC (ADIPOQ Produits)

Synonymes: anticorps ADP, anticorps DCAF9, anticorps 6720489L24Rik, anticorps 9330209L04Rik, anticorps Adp, anticorps Mamdc1, anticorps RNSVSP4U, anticorps SVSIV1, anticorps Svp4, anticorps ACDC, anticorps ACRP30, anticorps ADIPQTL1, anticorps ADPN, anticorps APM-1, anticorps APM1, anticorps GBP28, anticorps apM-1, anticorps 30kDa, anticorps APN, anticorps Acdc, anticorps Acrp30, anticorps Ad, anticorps adipo, anticorps apM1, anticorps ADN, anticorps acrpl, anticorps adipo-b, anticorps adipoql, anticorps zgc:153584, anticorps adipoq, anticorps WD and tetratricopeptide repeats 1, anticorps MAM domain containing glycosylphosphatidylinositol anchor 2, anticorps seminal vesicle secretory protein 4, anticorps adiponectin, C1Q and collagen domain containing, anticorps adiponectin, C1Q and collagen domain containing, b, anticorps adiponectin, C1Q and collagen domain containing L homeolog, anticorps WDTC1, anticorps Mdga2, anticorps Svs4, anticorps ADIPOQ, anticorps Adipoq, anticorps adipoqb, anticorps adipoq.L

Sujet: Adiponectin (ACDC) is expressed in adipose tissue exclusively. It is similar to collagens X and VIII and complement factor C1q. Adiponectin circulates in the plasma and is involved with metabolic and hormonal processes.

Poids moléculaire: 27 kDa (MW of target protein)