OR6C70 anticorps (C-Term)

N° du produit ABIN630295

Détail du produit anti-OR6C70 anticorps

Antigène: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OR6C70 est non-conjugé

Application: Western Blotting (WB)

Specificité: OR6 C70 antibody was raised against the C terminal of OR6 70

Purification: Purified

Immunogène: OR6 C70 antibody was raised using the C terminal of OR6 70 corresponding to a region with amino acids GSCMFIYIKPSANERVALSKGVTVLNTSVAPLLNPFIYTLRNQQVKQAFK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OR6C70 Blocking Peptide, catalog no. 33R-3552, is also available for use as a blocking control in assays to test for specificity of this OR6C70 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OR6C70

Antigène: OR6C70 (Olfactory Receptor, Family 6, Subfamily C, Member 70 (OR6C70))

Autre désignation: OR6C70 (OR6C70 Produits)

Synonymes: anticorps olfactory receptor family 6 subfamily C member 70, anticorps OR6C70

Sujet: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Poids moléculaire: 34 kDa (MW of target protein)