ZP2 anticorps

N° du produit ABIN630305

Détail du produit anti-ZP2 anticorps

Antigène: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ZP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZP2 Blocking Peptide, catalog no. 33R-7023, is also available for use as a blocking control in assays to test for specificity of this ZP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZP2

Antigène: ZP2 (Zona Pellucida Glycoprotein 2 (ZP2))

Autre désignation: ZP2 (ZP2 Produits)

Synonymes: anticorps fa12e07, anticorps wu:fa12e07, anticorps zgc:152728, anticorps zp2, anticorps Zp-2, anticorps ZPA, anticorps zona pellucida glycoprotein 2, tandem duplicate 5, anticorps zona pellucida glycoprotein 2, anticorps zp2.5, anticorps Zp2, anticorps ZP2

Sujet: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.

Poids moléculaire: 68 kDa (MW of target protein)