SLC10A5 anticorps

N° du produit ABIN630340

Détail du produit anti-SLC10A5 anticorps

Antigène: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC10A5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC10 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC10A5 Blocking Peptide, catalog no. 33R-3684, is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC10A5

Antigène: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Autre désignation: SLC10A5 (SLC10A5 Produits)

Synonymes: anticorps SLC10A5, anticorps Gm405, anticorps mP5, anticorps P5, anticorps solute carrier family 10 member 5, anticorps solute carrier family 10 (sodium/bile acid cotransporter family), member 5, anticorps sodium/bile acid cotransporter 5, anticorps solute carrier family 10, member 5, anticorps SLC10A5, anticorps LOC100456732, anticorps Slc10a5

Sujet: SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)