SLC10A5 anticorps
-
- Antigène Tous les produits SLC10A5
- SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC10A5 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- SLC10 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC10A5 Blocking Peptide, catalog no. 33R-3684, is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))
- Autre désignation
- SLC10A5 (SLC10A5 Produits)
- Synonymes
- anticorps SLC10A5, anticorps Gm405, anticorps mP5, anticorps P5, anticorps solute carrier family 10 member 5, anticorps solute carrier family 10 (sodium/bile acid cotransporter family), member 5, anticorps sodium/bile acid cotransporter 5, anticorps solute carrier family 10, member 5, anticorps SLC10A5, anticorps LOC100456732, anticorps Slc10a5
- Sujet
- SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.
- Poids moléculaire
- 48 kDa (MW of target protein)
-