STEAP3 anticorps (N-Term)
-
- Antigène Voir toutes STEAP3 Anticorps
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STEAP3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- STEAP3 antibody was raised against the N terminal of STEAP3
- Purification
- Purified
- Immunogène
- STEAP3 antibody was raised using the N terminal of STEAP3 corresponding to a region with amino acids LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY
- Top Product
- Discover our top product STEAP3 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STEAP3 Blocking Peptide, catalog no. 33R-5511, is also available for use as a blocking control in assays to test for specificity of this STEAP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STEAP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STEAP3 (STEAP Family Member 3, Metalloreductase (STEAP3))
- Autre désignation
- STEAP3 (STEAP3 Produits)
- Synonymes
- anticorps STEAP3, anticorps 1010001D01Rik, anticorps Tsap6, anticorps pHyde, anticorps AHMIO2, anticorps STMP3, anticorps TSAP6, anticorps dudlin-2, anticorps STEAP3 metalloreductase, anticorps STEAP family member 3, anticorps STEAP3, anticorps steap3, anticorps Steap3
- Sujet
- AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-