SLC7A14 anticorps

N° du produit ABIN630370

Détail du produit anti-SLC7A14 anticorps

Antigène: SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC7A14 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogène: SLC7 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC7A14 Blocking Peptide, catalog no. 33R-9413, is also available for use as a blocking control in assays to test for specificity of this SLC7A14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC7A14

Antigène: SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))

Autre désignation: SLC7A14 (SLC7A14 Produits)

Synonymes: anticorps SLC7A14, anticorps A930013N06, anticorps BC061928, anticorps solute carrier family 7 member 14, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 14, anticorps solute carrier family 7, member 14, anticorps SLC7A14, anticorps Slc7a14

Sujet: SLC7A14 possesses amino acid transmembrane transporter activity.

Poids moléculaire: 85 kDa (MW of target protein)