SLC7A14 anticorps
-
- Antigène Tous les produits SLC7A14
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
-
Reactivité
- Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC7A14 est non-conjugé
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Purification
- Purified
- Immunogène
- SLC7 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFFIGWNLILEYLIGTAAGASALSSMFDSLANHTISRWMADSVGTLNGL
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC7A14 Blocking Peptide, catalog no. 33R-9413, is also available for use as a blocking control in assays to test for specificity of this SLC7A14 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC7A14 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 14 (SLC7A14))
- Autre désignation
- SLC7A14 (SLC7A14 Produits)
- Synonymes
- anticorps SLC7A14, anticorps A930013N06, anticorps BC061928, anticorps solute carrier family 7 member 14, anticorps solute carrier family 7 (cationic amino acid transporter, y+ system), member 14, anticorps solute carrier family 7, member 14, anticorps SLC7A14, anticorps Slc7a14
- Sujet
- SLC7A14 possesses amino acid transmembrane transporter activity.
- Poids moléculaire
- 85 kDa (MW of target protein)
-