SLCO6A1 anticorps (N-Term)
-
- Antigène Voir toutes SLCO6A1 Anticorps
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLCO6A1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SLCO6 A1 antibody was raised against the N terminal of SLCO6 1
- Purification
- Purified
- Immunogène
- SLCO6 A1 antibody was raised using the N terminal of SLCO6 1 corresponding to a region with amino acids CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
- Top Product
- Discover our top product SLCO6A1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLCO6A1 Blocking Peptide, catalog no. 33R-1653, is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
- Autre désignation
- SLCO6A1 (SLCO6A1 Produits)
- Synonymes
- anticorps CT48, anticorps GST, anticorps OATP6A1, anticorps OATPY, anticorps SLCO6A1, anticorps solute carrier organic anion transporter family member 6A1, anticorps SLCO6A1
- Sujet
- SLCO6A1 is involved in transporter activity (solute carrier).
- Poids moléculaire
- 79 kDa (MW of target protein)
-