SLC36A3 anticorps

N° du produit ABIN630374

Détail du produit anti-SLC36A3 anticorps

Antigène: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC36A3 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Purification: Purified

Immunogène: SLC36 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC36A3 Blocking Peptide, catalog no. 33R-6462, is also available for use as a blocking control in assays to test for specificity of this SLC36A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC36A3

Antigène: SLC36A3 (Solute Carrier Family 36 (Proton/amino Acid Symporter), Member 3 (SLC36A3))

Autre désignation: SLC36A3 (SLC36A3 Produits)

Synonymes: anticorps PAT3, anticorps TRAMD2, anticorps tramdorin2, anticorps solute carrier family 36 (proton/amino acid symporter), member 3, anticorps solute carrier family 36 member 3, anticorps solute carrier family 36, member 3, anticorps Slc36a3, anticorps SLC36A3

Sujet: The function of SLC36A3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 52 kDa (MW of target protein)