ZDHHC17 anticorps (Middle Region)

N° du produit ABIN630405

Détail du produit anti-ZDHHC17 anticorps

Antigène: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZDHHC17 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZDHHC17 antibody was raised against the middle region of ZDHHC17

Purification: Purified

Immunogène: ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids FLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZDHHC17 Blocking Peptide, catalog no. 33R-2993, is also available for use as a blocking control in assays to test for specificity of this ZDHHC17 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZDHHC17

Antigène: ZDHHC17 (Zinc Finger, DHHC-Type Containing 17 (ZDHHC17))

Autre désignation: ZDHHC17 (ZDHHC17 Produits)

Synonymes: anticorps A230053P19Rik, anticorps BB187739, anticorps D130071N24Rik, anticorps Hip14, anticorps HIP14, anticorps HIP3, anticorps HYPH, anticorps si:ch211-81a6.1, anticorps zinc finger DHHC-type containing 17, anticorps zinc finger, DHHC domain containing 17, anticorps zinc finger, DHHC-type containing 17, anticorps ZDHHC17, anticorps zdhhc17, anticorps Zdhhc17

Sujet: ZDHHC17 is a palmitoyltransferase specific for a subset of neuronal proteins, including SNAP25, DLG4/PSD95, GAD2, SYT1 and HD. It may be involved in the sorting or targeting of critical proteins involved in the initiating events of endocytosis at the plasma membrane. It may be involved in the NF-kappa-B signaling pathway and has transforming activity.

Poids moléculaire: 44 kDa (MW of target protein)