LTC4S anticorps (N-Term)

N° du produit ABIN630425

Détail du produit anti-LTC4S anticorps

Antigène: LTC4S (Leukotriene C4 Synthase (LTC4S))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LTC4S est non-conjugé

Application: Western Blotting (WB)

Specificité: LTC4 S antibody was raised against the N terminal of LTC4

Purification: Purified

Immunogène: LTC4 S antibody was raised using the N terminal of LTC4 corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Information d'application

Indications d'application: WB: 1-2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LTC4S

Antigène: LTC4S (Leukotriene C4 Synthase (LTC4S))

Autre désignation: LTC4S (LTC4S Produits)

Synonymes: anticorps LTC4S, anticorps ltc4s, anticorps si:dkey-33h4.2, anticorps leukotriene C4 synthase, anticorps leukotriene C4 synthase-like, anticorps leukotriene C4 synthase, gene 1, anticorps Ltc4s, anticorps LTC4S, anticorps LTC4SL, anticorps ltc4s.1, anticorps ltc4s

Sujet: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin