TMED3 anticorps (C-Term)
-
- Antigène Voir toutes TMED3 Anticorps
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMED3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMED3 antibody was raised against the C terminal of TMED3
- Purification
- Purified
- Immunogène
- TMED3 antibody was raised using the C terminal of TMED3 corresponding to a region with amino acids DRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRPISRAVHS
- Top Product
- Discover our top product TMED3 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMED3 Blocking Peptide, catalog no. 33R-2139, is also available for use as a blocking control in assays to test for specificity of this TMED3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMED3 (Transmembrane Emp24 Protein Transport Domain Containing 3 (TMED3))
- Autre désignation
- TMED3 (TMED3 Produits)
- Synonymes
- anticorps wu:fb09b11, anticorps 1200002G13Rik, anticorps AW546672, anticorps P24b, anticorps TMED3, anticorps C15orf22, anticorps P24B, anticorps p26, anticorps transmembrane p24 trafficking protein 3, anticorps transmembrane emp24 domain-containing protein 3, anticorps tmed3, anticorps LOC100220305, anticorps Tmed3, anticorps TMED3
- Sujet
- The function of this gene remains unknown.
- Poids moléculaire
- 25 kDa (MW of target protein)
-