TSPAN32 anticorps (Middle Region)
-
- Antigène Voir toutes TSPAN32 Anticorps
- TSPAN32 (Tetraspanin 32 (TSPAN32))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSPAN32 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Tetraspanin 32 antibody was raised against the middle region of TSPAN32
- Purification
- Purified
- Immunogène
- Tetraspanin 32 antibody was raised using the middle region of TSPAN32 corresponding to a region with amino acids YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR
- Top Product
- Discover our top product TSPAN32 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Tetraspanin 32 Blocking Peptide, catalog no. 33R-10089, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 32 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN32 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSPAN32 (Tetraspanin 32 (TSPAN32))
- Autre désignation
- Tetraspanin 32 (TSPAN32 Produits)
- Synonymes
- anticorps TSPAN32, anticorps ART1, anticorps PHEMX, anticorps PHMX, anticorps TSSC6, anticorps AW208513, anticorps Art-1, anticorps BB235973, anticorps D7Wsu37e, anticorps Phemx, anticorps Tssc6, anticorps tetraspanin 32, anticorps TSPAN32, anticorps Tspan32
- Sujet
- This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as hematopoietic cell function.
- Poids moléculaire
- 31 kDa (MW of target protein)
-