GCNT3 anticorps
-
- Antigène Voir toutes GCNT3 Anticorps
- GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GCNT3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- GCNT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL
- Top Product
- Discover our top product GCNT3 Anticorps primaire
-
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 250-419) antibody
GCNT3 Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 390-418), (C-Term) antibodyGCNT3 Reactivité: Humain, Souris WB, IHC (p), FACS Hôte: Lapin Polyclonal RB24613 unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (Internal Region) antibodyVerified GCNT3 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) antibodyGCNT3 Reactivité: Humain ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (C-Term) antibodyGCNT3 Reactivité: Humain, Chien, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 273-284) antibodyVerified GCNT3 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (C-Term) antibodyGCNT3 Reactivité: Humain, Souris, Rat, Chien, Cheval, Porc, Lapin, Boeuf (Vache), Saccharomyces cerevisiae, Mouton, Cobaye WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 390-418), (C-Term) antibodyGCNT3 Reactivité: Humain, Souris WB, IHC (p), FACS, EIA Hôte: Lapin Polyclonal unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 73-102), (N-Term) antibodyGCNT3 Reactivité: Humain WB Hôte: Lapin Polyclonal RB36615 unconjugated
anti-Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3) (AA 27-180) antibodyGCNT3 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GCNT3 Blocking Peptide, catalog no. 33R-1261, is also available for use as a blocking control in assays to test for specificity of this GCNT3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCNT3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GCNT3 (Glucosaminyl (N-Acetyl) Transferase 3, Mucin Type (GCNT3))
- Autre désignation
- GCNT3 (GCNT3 Produits)
- Synonymes
- anticorps C2/4GnT, anticorps C24GNT, anticorps C2GNT2, anticorps C2GNTM, anticorps GNTM, anticorps 2010013H22Rik, anticorps 2210021I22Rik, anticorps 2210401J11Rik, anticorps beta-16-N-acetylglucosaminyltransferase, anticorps dI/C2/C4GnT, anticorps c2/4gnt, anticorps c24gnt, anticorps c2gnt2, anticorps c2gntm, anticorps gntm, anticorps glucosaminyl (N-acetyl) transferase 3, mucin type, anticorps glucosaminyl (N-acetyl) transferase 3, mucin type L homeolog, anticorps GCNT3, anticorps Gcnt3, anticorps gcnt3.L
- Sujet
- This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response
-
