RHAG anticorps (Middle Region)

N° du produit ABIN630486

Détail du produit anti-RHAG anticorps

Antigène: RHAG (Rh Family A Glycoprotein (RHAG))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHAG est non-conjugé

Application: Western Blotting (WB)

Specificité: RHAG antibody was raised against the middle region of RHAG

Purification: Purified

Immunogène: RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHAG

Antigène: RHAG (Rh Family A Glycoprotein (RHAG))

Autre désignation: RHAG (RHAG Produits)

Synonymes: anticorps CD241, anticorps RH2, anticorps RH50A, anticorps Rh50, anticorps Rh50GP, anticorps SLC42A1, anticorps Rh50A, anticorps Rh-associated glycoprotein, anticorps Rh associated glycoprotein, anticorps Rhesus blood group-associated A glycoprotein, anticorps RHAG, anticorps Rhag

Sujet: The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.

Poids moléculaire: 45 kDa (MW of target protein)