NR0B2 anticorps (N-Term)

N° du produit ABIN630500

Détail du produit anti-NR0B2 anticorps

Antigène: NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR0B2 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR0 B2 antibody was raised against the N terminal of NR0 2

Purification: Affinity purified

Immunogène: NR0 B2 antibody was raised using the N terminal of NR0 2 corresponding to a region with amino acids STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR0B2 Blocking Peptide, catalog no. 33R-8889, is also available for use as a blocking control in assays to test for specificity of this NR0B2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR0B2

Antigène: NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))

Autre désignation: NR0B2 (NR0B2 Produits)

Synonymes: anticorps SHP, anticorps SHP1, anticorps SHP-1, anticorps Shp1, anticorps Shp, anticorps NR0B2-A, anticorps Nr0b2, anticorps SHP-A, anticorps gb:bc058069, anticorps nuclear receptor subfamily 0 group B member 2, anticorps nuclear receptor subfamily 0, group B, member 2, anticorps nuclear receptor subfamily 0, group B, member 2a, anticorps NR0B2, anticorps Nr0b2, anticorps nr0b2a

Sujet: NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway