NR2F6 anticorps (N-Term)

N° du produit ABIN630502

Détail du produit anti-NR2F6 anticorps

Antigène: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR2F6 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR2 F6 antibody was raised against the N terminal of NR2 6

Purification: Affinity purified

Immunogène: NR2 F6 antibody was raised using the N terminal of NR2 6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR2F6 Blocking Peptide, catalog no. 33R-1199, is also available for use as a blocking control in assays to test for specificity of this NR2F6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR2F6

Antigène: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Autre désignation: NR2F6 (NR2F6 Produits)

Synonymes: anticorps EAR-2, anticorps EAR2, anticorps ERBAL2, anticorps AV090102, anticorps COUP-TF3, anticorps Erbal2, anticorps COUP(II), anticorps NR2F6, anticorps couptf2, anticorps fc94g11, anticorps wu:fc94g11, anticorps zgc:77259, anticorps ear-2, anticorps ear2, anticorps erbal2, anticorps nr2f6l, anticorps wu:fc72d04, anticorps zgc:77260, anticorps nuclear receptor subfamily 2 group F member 6, anticorps nuclear receptor subfamily 2, group F, member 6, anticorps nuclear receptor subfamily 2, group F, member 6a, anticorps nuclear receptor subfamily 2 group F member 6 L homeolog, anticorps nuclear receptor subfamily 2, group F, member 6b, anticorps NR2F6, anticorps Nr2f6, anticorps nr2f6a, anticorps nr2f6.L, anticorps nr2f6, anticorps nr2f6b

Sujet: Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).

Poids moléculaire: 43 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Photoperiodism