NR0B1 anticorps (N-Term)
-
- Antigène Voir toutes NR0B1 Anticorps
- NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NR0B1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NR0 B1 antibody was raised against the N terminal of NR0 1
- Purification
- Affinity purified
- Immunogène
- NR0 B1 antibody was raised using the N terminal of NR0 1 corresponding to a region with amino acids MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG
- Top Product
- Discover our top product NR0B1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NR0B1 Blocking Peptide, catalog no. 33R-5660, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))
- Autre désignation
- NR0B1 (NR0B1 Produits)
- Synonymes
- anticorps DAX, anticorps NR0B1, anticorps dax1, anticorps AHC, anticorps AHCH, anticorps AHX, anticorps DAX-1, anticorps DAX1, anticorps DSS, anticorps GTD, anticorps HHG, anticorps NROB1, anticorps SRXY2, anticorps Ahc, anticorps Ahch, anticorps Dax1, anticorps nuclear receptor subfamily 0 group B member 1, anticorps nuclear receptor subfamily 0, group B, member 1, anticorps nuclear receptor subfamily 0 group B member 1 L homeolog, anticorps NR0B1, anticorps nr0b1, anticorps nr0b1.L, anticorps Nr0b1
- Sujet
- NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling
-