NR0B1 anticorps (N-Term)

N° du produit ABIN630505

Détail du produit anti-NR0B1 anticorps

Antigène: NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR0B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR0 B1 antibody was raised against the N terminal of NR0 1

Purification: Affinity purified

Immunogène: NR0 B1 antibody was raised using the N terminal of NR0 1 corresponding to a region with amino acids MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR0B1 Blocking Peptide, catalog no. 33R-5660, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR0B1

Antigène: NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))

Autre désignation: NR0B1 (NR0B1 Produits)

Synonymes: anticorps DAX, anticorps NR0B1, anticorps dax1, anticorps AHC, anticorps AHCH, anticorps AHX, anticorps DAX-1, anticorps DAX1, anticorps DSS, anticorps GTD, anticorps HHG, anticorps NROB1, anticorps SRXY2, anticorps Ahc, anticorps Ahch, anticorps Dax1, anticorps nuclear receptor subfamily 0 group B member 1, anticorps nuclear receptor subfamily 0, group B, member 1, anticorps nuclear receptor subfamily 0 group B member 1 L homeolog, anticorps NR0B1, anticorps nr0b1, anticorps nr0b1.L, anticorps Nr0b1

Sujet: NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling