NR2F1 anticorps (C-Term)
-
- Antigène Voir toutes NR2F1 Anticorps
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NR2F1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NR2 F1 antibody was raised against the C terminal of NR2 1
- Purification
- Affinity purified
- Immunogène
- NR2 F1 antibody was raised using the C terminal of NR2 1 corresponding to a region with amino acids VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP
- Top Product
- Discover our top product NR2F1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NR2F1 Blocking Peptide, catalog no. 33R-9656, is also available for use as a blocking control in assays to test for specificity of this NR2F1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NR2F1 (Nuclear Receptor Subfamily 2, Group F, Member 1 (NR2F1))
- Autre désignation
- NR2F1 (NR2F1 Produits)
- Synonymes
- anticorps COUP-TFI, anticorps EAR-3, anticorps EAR3, anticorps ERBAL3, anticorps NR2F2, anticorps SVP44, anticorps TCFCOUP1, anticorps TFCOUP1, anticorps COUP-TF1, anticorps COUPTFA, anticorps Erbal3, anticorps Tcfcoup1, anticorps COUP(VI), anticorps couptf6, anticorps fc10d05, anticorps nr2f1, anticorps svp44, anticorps wu:fc10d05, anticorps COUP-TF, anticorps ear3, anticorps ear-3, anticorps nr2f2, anticorps erbal3, anticorps tfcoup1, anticorps coup-tfi, anticorps tcfcoup1, anticorps nr2f1l, anticorps zgc:65854, anticorps zgc:77353, anticorps nuclear receptor subfamily 2 group F member 1, anticorps nuclear receptor subfamily 2, group F, member 1, anticorps nuclear receptor subfamily 2, group F, member 1a, anticorps nuclear receptor subfamily 2 group F member 1 L homeolog, anticorps nuclear receptor subfamily 2, group F, member 1b, anticorps NR2F1, anticorps Nr2f1, anticorps nr2f1a, anticorps nr2f1.L, anticorps nr2f1, anticorps nr2f1b
- Sujet
- Coup (chicken ovalbumin upstream promoter) transcription factor binds to the ovalbumin promoter and, in conjunction with another protein (S300-II) stimulates initiation of transcription. NR2F1 binds to both direct repeats and palindromes of the 5'-AGGTCA-3' motif.
- Poids moléculaire
- 46 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-