ZNF33A anticorps (Middle Region)

N° du produit ABIN630524

Détail du produit anti-ZNF33A anticorps

Antigène: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF33A est non-conjugé

Application: Western Blotting (WB)

Specificité: ZNF33 A antibody was raised against the middle region of ZNF33

Purification: Affinity purified

Immunogène: ZNF33 A antibody was raised using the middle region of ZNF33 corresponding to a region with amino acids LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD

Information d'application

Indications d'application: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF33A Blocking Peptide, catalog no. 33R-5320, is also available for use as a blocking control in assays to test for specificity of this ZNF33A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZNF33A

Antigène: ZNF33A (Zinc Finger Protein 33A (ZNF33A))

Autre désignation: ZNF33A (ZNF33A Produits)

Synonymes: anticorps KOX2, anticorps KOX31, anticorps KOX5, anticorps NF11A, anticorps ZNF11, anticorps ZNF11A, anticorps ZNF33, anticorps ZZAPK, anticorps zinc finger protein 33A, anticorps ZNF33A

Sujet: ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.

Poids moléculaire: 80 kDa (MW of target protein)