SAMSN1 anticorps (Middle Region)
-
- Antigène Voir toutes SAMSN1 Anticorps
- SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAMSN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SAMSN1 antibody was raised against the middle region of SAMSN1
- Purification
- Affinity purified
- Immunogène
- SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids YVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGY
- Top Product
- Discover our top product SAMSN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SAMSN1 Blocking Peptide, catalog no. 33R-10272, is also available for use as a blocking control in assays to test for specificity of this SAMSN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMSN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SAMSN1 (SAM Domain, SH3 Domain and Nuclear Localization Signals, 1 (SAMSN1))
- Autre désignation
- SAMSN1 (SAMSN1 Produits)
- Synonymes
- anticorps HACS1, anticorps NASH1, anticorps SASH2, anticorps SH3D6B, anticorps SLy2, anticorps 4930571B16Rik, anticorps 930571B16Rik, anticorps Hacs1, anticorps Nash, anticorps samsn1, anticorps wu:fa92h05, anticorps wu:fq83f12, anticorps SAMSN1, anticorps zgc:103427, anticorps SAM domain, SH3 domain and nuclear localization signals 1, anticorps SAM domain, SH3 domain and nuclear localization signals, 1, anticorps SAM domain, SH3 domain and nuclear localisation signals 1a, anticorps SAM domain, SH3 domain and nuclear localisation signals 1b, anticorps SAMSN1, anticorps Samsn1, anticorps samsn1a, anticorps samsn1b
- Sujet
- SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.
- Poids moléculaire
- 42 kDa (MW of target protein)
-