LCA5L anticorps
-
- Antigène Tous les produits LCA5L
- LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LCA5L est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- C21 ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C21ORF13 Blocking Peptide, catalog no. 33R-3556, is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))
- Autre désignation
- C21ORF13 (LCA5L Produits)
- Synonymes
- anticorps C21orf13, anticorps 4921526F01Rik, anticorps Lcca5l, anticorps Leber congenital amaurosis 5-like, anticorps LCA5L, lebercilin like, anticorps LCA5L, anticorps Lca5l
- Sujet
- The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 76 kDa (MW of target protein)
-