LCA5L anticorps

N° du produit ABIN630546

Cet anticorps anti-LCA5L Polyclonal Lapin (ABIN630546) détecte spécifiquement LCA5L dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour LCA5L anticorps (ABIN630546)

Antigène: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LCA5L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LCA5L anticorps

Purification: Affinity purified

Immunogène: C21 ORF13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSEEPLQSKESHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF13 Blocking Peptide, (ABIN938942), is also available for use as a blocking control in assays to test for specificity of this C21ORF13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LCA5L

Antigène: LCA5L (Leber Congenital Amaurosis 5-Like (LCA5L))

Autre désignation: C21ORF13

Sujet: The function of the C21orf13 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 76 kDa (MW of target protein)