FSTL5 anticorps (Middle Region)

N° du produit ABIN630564

Détail du produit anti-FSTL5 anticorps

Antigène: FSTL5 (Follistatin-Like 5 (FSTL5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FSTL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: FSTL5 antibody was raised against the middle region of FSTL5

Purification: Affinity purified

Immunogène: FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FSTL5 Blocking Peptide, catalog no. 33R-6862, is also available for use as a blocking control in assays to test for specificity of this FSTL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSTL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FSTL5

Antigène: FSTL5 (Follistatin-Like 5 (FSTL5))

Autre désignation: FSTL5 (FSTL5 Produits)

Synonymes: anticorps Mahya, anticorps FSTL5, anticorps drMahya-1, anticorps zgc:136225, anticorps 9130207J01Rik, anticorps follistatin-like 5, anticorps follistatin like 5, anticorps follistati like 5, anticorps Fstl5, anticorps FSTL5, anticorps fstl5

Sujet: The function of Follistatin protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 92 kDa (MW of target protein)