FSTL5 anticorps (Middle Region)
-
- Antigène Voir toutes FSTL5 Anticorps
- FSTL5 (Follistatin-Like 5 (FSTL5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FSTL5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FSTL5 antibody was raised against the middle region of FSTL5
- Purification
- Affinity purified
- Immunogène
- FSTL5 antibody was raised using the middle region of FSTL5 corresponding to a region with amino acids NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD
- Top Product
- Discover our top product FSTL5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FSTL5 Blocking Peptide, catalog no. 33R-6862, is also available for use as a blocking control in assays to test for specificity of this FSTL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FSTL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FSTL5 (Follistatin-Like 5 (FSTL5))
- Autre désignation
- FSTL5 (FSTL5 Produits)
- Synonymes
- anticorps Mahya, anticorps FSTL5, anticorps drMahya-1, anticorps zgc:136225, anticorps 9130207J01Rik, anticorps follistatin-like 5, anticorps follistatin like 5, anticorps follistati like 5, anticorps Fstl5, anticorps FSTL5, anticorps fstl5
- Sujet
- The function of Follistatin protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 92 kDa (MW of target protein)
-