Cardiac Troponin T2 anticorps

N° du produit ABIN630581

Détail du produit anti-Cardiac Troponin T2 anticorps

Antigène: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cardiac Troponin T2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Troponin T Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Troponin T Type 2 Blocking Peptide, catalog no. 33R-2732, is also available for use as a blocking control in assays to test for specificity of this Troponin T Type 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cardiac Troponin T2

Antigène: Cardiac Troponin T2 (cTnT) (Cardiac Troponin T (cTnT))

Abstract: cTnT Produits

Synonymes: anticorps CMH2, anticorps CMPD2, anticorps LVNC6, anticorps RCM3, anticorps TnTC, anticorps cTnT, anticorps Tnt, anticorps CTTG, anticorps Ctt, anticorps RATCTTG, anticorps Tnnt3, anticorps tnnt2, anticorps CT3, anticorps si:ch211-136g2.1, anticorps troponin T2, cardiac type, anticorps troponin T2, cardiac, anticorps troponin T type 2a (cardiac), anticorps troponin T2, cardiac type L homeolog, anticorps troponin T2e, cardiac, anticorps TNNT2, anticorps Tnnt2, anticorps tnnt2a, anticorps tnnt2.L, anticorps tnnt2e

Sujet: TNNT2 is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in the gene encoding TNNT2 have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.

Poids moléculaire: 35 kDa (MW of target protein)